PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008138m
Common NameCICLE_v10008135mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 484aa    MW: 52880.8 Da    PI: 6.5133
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008138mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.66.8e-25172228259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+++g H h+
  Ciclev10008138m 172 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSDCCAKK-IECSDHSGHVIEIVNKGMHSHD 228
                      8********************************98.*********************7 PP

2WRKY98.73.8e-31346402359
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Ciclev10008138m 346 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTSAVIITYKGVHDHD 402
                      9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-19165230IPR003657WRKY domain
SuperFamilySSF1182902.75E-19168230IPR003657WRKY domain
SMARTSM007747.7E-23171229IPR003657WRKY domain
PROSITE profilePS5081116.926172230IPR003657WRKY domain
PfamPF031064.1E-16173227IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-31329404IPR003657WRKY domain
PROSITE profilePS5081131.927339404IPR003657WRKY domain
SuperFamilySSF1182906.67E-27340404IPR003657WRKY domain
SMARTSM007742.5E-35344403IPR003657WRKY domain
PfamPF031061.8E-23346401IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MAESESFEAR KRHENPQNDE FEEEEEEEDE EILDDEEEDE GASQLTEPHQ LQLTENNKHH  60
KGLQVNSGVE SNEGTKLKVE VSQHEGSGSI AVQAAESQTQ YQLQPSICPT SLSELSPTSV  120
TEPISSAPSP TLTGQNLSLV KVDTASVPEA NLQNSSELKN VSVVHIVKTP VSDGYNWRKY  180
GQKQVKSPKG SRSYYKCTYS DCCAKKIECS DHSGHVIEIV NKGMHSHDPP RKNNCVRESR  240
LISSVGPVIG NNITEQSLRM LNDSVPSTSS KDSVRDSNLV PERKRPNLSS FAGDGEVSVK  300
EEHPSEPEPK RRVKKDNLAN SSPLLKPGKK PKFVVHAAGD VGISGDGYRW RKYGQKMVKG  360
NPNPRNYYRC TSAGCPVRKH IETAVDNTSA VIITYKGVHD HDMPVPKKRH GPPSAPLVAA  420
AAPASMNNLQ LKKTDAVQNQ TTSTQWSVRT EGELAGAAMD LGGEKAMESA RTLLSIGFEI  480
KPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A7e-26332404274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2360330.0JX236033.1 Citrus trifoliata WRKY2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453623.10.0hypothetical protein CICLE_v10008135mg
SwissprotP595831e-146WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4U2020.0V4U202_9R
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-133WRKY DNA-binding protein 32